PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G183600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MIKC_MADS
Protein Properties Length: 228aa    MW: 25640.4 Da    PI: 9.947
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G183600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF953.4e-30959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krien++ rqvtfskRrng+lKKA+ELSvLCdaevav++fs++g+lye++s
  Brast03G183600.1.p  9 KRIENTTSRQVTFSKRRNGLLKKAFELSVLCDAEVAVVVFSPRGRLYEFAS 59
                        79***********************************************86 PP

2K-box60.47.5e-2178172599
               K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                          +k++++++ ++ + +   L k++e L+ ++R++lGe+L+ +s +eL+ Le ++eksl  iR+kK+++l +qi +l++ke +l ++n++Lr
  Brast03G183600.1.p  78 VNKKTAQQDIQQVRVDTISLAKKLEALEDSKRKILGENLGGCSTQELHILEVKIEKSLHIIRAKKSQMLEQQIAKLKEKETMLLKDNEDLR 168
                         345588899999999999************************************************************************* PP

               K-box  96 kkle 99 
                         +k +
  Brast03G183600.1.p 169 EKQQ 172
                         9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.8E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.567161IPR002100Transcription factor, MADS-box
CDDcd002652.57E-39376No hitNo description
PRINTSPR004041.3E-30323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.01E-31384IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.0E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-303859IPR002100Transcription factor, MADS-box
PfamPF014869.8E-2283170IPR002487Transcription factor, K-box
PROSITE profilePS5129712.65987177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009409Biological Processresponse to cold
GO:0009739Biological Processresponse to gibberellin
GO:0009911Biological Processpositive regulation of flower development
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MVRGKTELKR IENTTSRQVT FSKRRNGLLK KAFELSVLCD AEVAVVVFSP RGRLYEFASS  60
TSLQKTIDRY KAYTKDNVNK KTAQQDIQQV RVDTISLAKK LEALEDSKRK ILGENLGGCS  120
TQELHILEVK IEKSLHIIRA KKSQMLEQQI AKLKEKETML LKDNEDLREK QQHLAALTVV  180
PSLNRVALAP LQQEPEPEPS SDAIDAVETE LFIGLPGRER SSNRQSG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A7e-18373271Myocyte-specific enhancer factor 2A
3mu6_B7e-18373271Myocyte-specific enhancer factor 2A
3mu6_C7e-18373271Myocyte-specific enhancer factor 2A
3mu6_D7e-18373271Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00076ChIP-chipTransfer from AT2G45660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693200.0KF469320.1 Brachypodium distachyon MADS-box transcription factor 25 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288329.11e-142MADS-box transcription factor 56-like
RefseqXP_010233635.11e-142PREDICTED: MADS-box transcription factor 56-like isoform X1
SwissprotA2Z9Q71e-108MAD56_ORYSI; MADS-box transcription factor 56
TrEMBLI1I5Q01e-142I1I5Q0_BRADI; MADS-box transcription factor 25
STRINGBRADI3G32090.11e-141(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.15e-68AGAMOUS-like 20